PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009802843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 206aa    MW: 22650.3 Da    PI: 10.3631
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009802843.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.11.5e-16135182350
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     ++++ +r++kNRe+A rsR+RK+a++ eLe+kv+ L +eN +Lkk+ +
  XP_009802843.1 135 SDQKNKRMIKNRESAARSRARKQAYTNELEQKVAHLMEENVRLKKQQQ 182
                     7899****************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-14128182No hitNo description
SMARTSM003383.5E-11133201IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921135184IPR004827Basic-leucine zipper domain
PfamPF001703.4E-14136181IPR004827Basic-leucine zipper domain
CDDcd147071.84E-24137191No hitNo description
SuperFamilySSF579592.19E-11138183No hitNo description
PROSITE patternPS000360140155IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEEVWKNINL SSLNGDTTTS SRDHIDPQQN ISNSTNFGGM ILQDFLARPF ANNPKTAAKG  60
YVPPIFPPPA AAAAVTVLTL NSGPGLHFFG NLRQNSSSEQ QKSISNTSFE DLASPVGGNT  120
NGRKRCSESD DNNSSDQKNK RMIKNRESAA RSRARKQAYT NELEQKVAHL MEENVRLKKQ  180
QQPLCLAAAA QLPKKKSLYR TSTAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802843.11e-153PREDICTED: protein FD-like
SwissprotQ84JK22e-42FD_ARATH; Protein FD
TrEMBLM1C7G19e-63M1C7G1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000614033e-62(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35722239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.21e-29basic region/leucine zipper motif 27